PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1792_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 234aa    MW: 26470.6 Da    PI: 4.7094
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1792_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.74e-203477346
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                    +nk   qvtfskRr+g++ KA EL+vLC+aev +i+fs++gk+
  Neem_1792_f_1 34 LQNKNSLQVTFSKRRTGLFSKAMELCVLCGAEVGIIVFSPSGKI 77
                   6799999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-312483IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.6842484IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-2625112IPR002100Transcription factor, MADS-box
CDDcd002651.04E-322593No hitNo description
PRINTSPR004041.3E-192646IPR002100Transcription factor, MADS-box
PfamPF003191.5E-213578IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-194661IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-196182IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MSSSISNTNN GGNNDNHNTK KTTRGRQKIE IKKLQNKNSL QVTFSKRRTG LFSKAMELCV  60
LCGAEVGIIV FSPSGKIFVV GHPDFDTILN RYLGENQYEQ AAAVPSVEQH NREYEEALIE  120
LEMEKTRGKI IEEEKEKNNE GKAWWEESID GMGIEELEEY VKAMNKLRSK VESRVNEMMM  180
MNEYLMPNNI NITNREDGFG NVVSSSNNEE ISVDGGCTVA DFDFGENFSI IHNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-1525118187Myocyte-specific enhancer factor 2A
3kov_B4e-1525118187Myocyte-specific enhancer factor 2A
3kov_I4e-1525118187Myocyte-specific enhancer factor 2A
3kov_J4e-1525118187Myocyte-specific enhancer factor 2A
3p57_A4e-1525118187Myocyte-specific enhancer factor 2A
3p57_B4e-1525118187Myocyte-specific enhancer factor 2A
3p57_C4e-1525118187Myocyte-specific enhancer factor 2A
3p57_D4e-1525118187Myocyte-specific enhancer factor 2A
3p57_I4e-1525118187Myocyte-specific enhancer factor 2A
3p57_J4e-1525118187Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422729.17e-89hypothetical protein CICLE_v10030327mg, partial
RefseqXP_006487056.19e-89PREDICTED: agamous-like MADS-box protein AGL23
TrEMBLV4U9K67e-89V4U9K6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-28AGAMOUS-like 62